RMND5B Rabbit Polyclonal Antibody TA331766 from OriGene Technologies | Biocompare.com

Supplier Images

RMND5B Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RMND5B Rabbit Polyclonal Antibody

OriGene Technologies' RMND5B Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RMND5B Rabbit Polyclonal Antibody was generated using Rmnd5b as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-RMND5B Antibody

Product Specs
ItemRMND5B Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA331766
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetRMND5B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RMND5B Antibody is: synthetic peptide directed towards the N-terminal region of Human RMND5B. Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL
NCBI Full Gene Namerequired for meiotic nuclear division 5 homolog B
NCBI Gene AliasesGID2B, GID2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!